Pax2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Pax2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Pax2 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Paired box protein Pax-2(PAX2) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Paired box gene 2, also known as PAX2, is a protein which in humans is encoded by the PAX2 gene. This gene is mapped to 10q24. PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Pax2 (248-282aa RKHLRADTFTQQQLEALDRVFERPSYPDVFQASEH), identical to the related mouse sequence. Ig Type: Rabbit IgG |
| Other Names | [Paired box protein Pax-2; Paired box 2; Paired box gene 2; paired box homeotic gene 2; paired box protein 2; Paired box protein Pax 2; Paired box protein Pax-2; Paired box protein Pax2; Pax 2; paired box 2], [PAX2; PAX2; FSGS7; PAPRS] |
| Gene, Accession # | [PAX2], Gene ID: 5076, NCBI: NP_000269.3, UniProt: Q02962 |
| Catalog # | MBS178017 |
| Price | $315 |
| Order / More Info | Pax2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: PAX2 paired box gene 2. 2. Pilz AJ, Povey S, Gruss P, Abbott CM (1993). Mapping of the human homologs of the murine paired-box-containing genes. Mamm. Genome 4 (2): 78-82. 3. Pfeffer, Peter L.; Bernhard Payter; Gerlinde Reim; Marina Pasca di Magliano; Meinrad Busslinger (2001). The activation and maintenance of Pax2 expression at the mid-hindbrain boundary is controlled by separate enhancers. Development (133): 307-318. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies