Edit |   |
---|---|
Antigenic Specificity | IGFBP3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 2.72 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human IGFBP3 (NP 000589.2). Immunogen Sequence: EARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNF |
Other Names | [IGFBP3; BP-53; IBP3; insulin-like growth factor-binding protein 3] |
Gene, Accession # | [IGFBP3], Gene ID: 3486, NCBI: NP_000589.2, UniProt: P17936 |
Catalog # | MBS9140691 |
Price | $260 |
Order / More Info | IGFBP3 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |