Edit |   |
---|---|
Antigenic Specificity | JAK1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit IgG polyclonal antibody for Tyrosine-protein kinase JAK1(JAK1) detection. Background: JAK1 (JANUS KINASE 1) is a human tyrosine kinase protein essential for signaling for certain type I and type II cytokines. It is a member of a new class of PTKs that are a large family of proteins characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain--hence the name Janus. The JAK1 gene is mapped to 1p31.3. JAK1 is also important for transducing a signal by type I (IFN-alpha/beta) and type II (IFN-gamma) interferons, and members of the IL-10 family via type II cytokine receptors. Additionally, Jak1 plays a critical role in initiating responses to multiple major cytokine receptor families |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1 (78-115aa FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN), different from the related mouse sequence by three amino acids. |
Other Names | [JAK 1A; JAK-1; JAK1A; JAK1B; Tyrosineprotein kinase JAK1; Tyrosine-protein kinase JAK1; P23458; Janus kinase 1], [JAK1; JAK1; JTK3; JAK1A; JAK1B; JAK1A; JAK1B; JAK-1] |
Gene, Accession # | [JAK1], Gene ID: 3716, NCBI: NP_001307852.1, UniProt: P23458 |
Catalog # | MBS178603 |
Price | $280 |
Order / More Info | JAK1 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Gadina M, Hilton D, Johnston JA, Morinobu A, Lighvani A, Zhou YJ, Visconti R, O'Shea JJ (2001). Signaling by type I and II cytokine receptors: ten years after.2. Gough, N. M., Rakar, S., Harpur, A., Wilks, A. F. Localization of genes for two members of the JAK family of protein tyrosine kinases to murine chromosomes 4 and 19. Mammalian Genome 6: 247-248, 1995.3. Howard, O. M. Z., Dean, M., Young, H., Ramsburg, M., Turpin, J. A., Michiel, D. F., Kelvin, D. J., Lee, L., Farrar, W. L. Characterization of a class 3 tyrosine kinase. Oncogene 7: 895-900, 1992. |