Edit |   |
---|---|
Antigenic Specificity | Calbindin 2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: Calbindin 2 antibody was raised against the N terminal of CALB2. Rabbit polyclonal Calbindin 2 antibody raised against the N terminal of CALB2 |
Immunogen | Immunogen: Calbindin 2 antibody was raised using the N terminal of CALB2 corresponding to a region with amino acids IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD |
Other Names | [Calbindin 2; Calbindin 2; CALB2; CAL2] |
Gene, Accession # | n/a |
Catalog # | MBS5303039 |
Price | $460 |
Order / More Info | Calbindin 2 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |