Annexin A5 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Annexin A5 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Annexin A5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, dog |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 0.1 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: Annexin A5 antibody was raised against the N terminal of ANXA5. The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. |
| Immunogen | Immunogen: Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids AYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVV |
| Other Names | [Rabbit Annexin A5 raised against the N terminal of ANXA5; Annexin A5; Annexin A5; Annexin A-5; Annexin A-5; ANXA5; Annexin A 5; Annexin A5; Annexin A 5] |
| Gene, Accession # | [ANXA5], Gene ID: 308, UniProt: P08758 |
| Catalog # | MBS5313170 |
| Price | $375 |
| Order / More Info | Annexin A5 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies