Edit |   |
---|---|
Antigenic Specificity | PIK3CD |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 2.68 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I PI3K found primarily in leukocytes. Like other class I PI3Ks (p110-alpha p110-beta, and p110-gamma), the encoded protein binds p85 adapter proteins and GTP-bound RAS. However, unlike the other class I PI3Ks, this protein phosphorylates itself, not p85 protein. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human PIK3CD (NP 005017.3). Immunogen Sequence: AAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYL |
Other Names | [PIK3CD; APDS; IMD14; P110DELTA; PI3K; p110D; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta] |
Gene, Accession # | [PIK3CD], Gene ID: 5293, NCBI: O00329.2, UniProt: O00329 |
Catalog # | MBS9140795 |
Price | $260 |
Order / More Info | PIK3CD Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |