RUNX2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-RUNX2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | RUNX2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse. |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human;Mouse. Background: Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initi |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence. |
| Other Names | [Acute myeloid leukemia 3 protein; Alpha subunit 1; AML3; CBF alpha 1; CBF-alpha-1; CBFA1; CCD; CCD1; Cleidocranial dysplasia 1; Core binding factor; Core binding factor runt domain alpha subunit 1; Core binding factor subunit alpha 1; Core-binding factor subunit alpha-1; MGC120022; MGC120023; Oncogene AML 3; Oncogene AML-3; OSF 2; OSF-2; OSF2; Osteoblast specific transcription factor 2; Osteoblast-specific transcription factor 2; OTTHUMP00000016533; PEA2 alpha A; PEA2-alpha A; PEA2aA; PEBP2 alpha A; PEBP2-alpha A; PEBP2A1; PEBP2A2; PEBP2aA; PEBP2aA; PEBP2aA1; Polyomavirus enhancer binding protein 2 alpha A subunit; Polyomavirus enhancer-binding protein 2 alpha A subunit; Runt domain; Runt related transcription factor 2; Runt-related transcription factor 2; RUNX2; RUNX2_HUMAN; SL3 3 enhancer factor 1 alpha A subunit; SL3-3 enhancer factor 1 alpha A subunit; SL3/AKV core binding factor alpha A subunit; SL3/AKV core-binding factor alpha A subunit; runt-related transcription factor 2], [RUNX2; RUNX2; CCD; AML3; CCD1; CLCD; OSF2; CBFA1; OSF-2; PEA2aA; PEBP2aA; CBF-alpha-1; AML3; CBFA1; OSF2; PEBP2A; CBF-alpha-1; OSF-2; PEA2-alpha A; PEBP2-alpha A] |
| Gene, Accession # | [RUNX2], Gene ID: 860, NCBI: NP_001015051.3, UniProt: Q13950 |
| Catalog # | MBS177425 |
| Price | $280 |
| Order / More Info | RUNX2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies