Edit |   |
---|---|
Antigenic Specificity | CD80 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 2.82 mg/ml |
Applications | Western Blot (WB), Immunofluorescence (IF) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD80 (NP 005182.1). Immunogen Sequence: MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS |
Other Names | [CD80; B7; B7-1; B7.1; BB1; CD28LG; CD28LG1; LAB7; CD80 molecule] |
Gene, Accession # | [CD80], Gene ID: 941, NCBI: P33681.1, UniProt: P33681 |
Catalog # | MBS9140683 |
Price | $260 |
Order / More Info | CD80 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |