Periplakin Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Periplakin antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Periplakin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Periplakin(PPL) detection. Background: Periplakin is a protein that in humans is encoded by the PPL gene. The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Periplakin (1664-1701aa DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK), different from the related mouse sequence by one amino acid. |
| Other Names | [Periplakin; ppl; O60437], [PPL; PPL; KIAA0568] |
| Gene, Accession # | [PPL], Gene ID: 5493, NCBI: NP_002696.3, UniProt: O60437 |
| Catalog # | MBS178660 |
| Price | $315 |
| Order / More Info | Periplakin Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: PPL periplakin.2. Aho S, McLean WH, Li K, Uitto J (Jun 1998). cDNA cloning, mRNA expression, and chromosomal mapping of human and mouse periplakin genes. Genomics. 48 (2): 242-7.3. Kazerounian, Shideh; Uitto Jouni; Aho Sirpa (Oct 2002). Unique role for the periplakin tail in intermediate filament association: specific binding to keratin 8 and vimentin. Exp. Dermatol. Denmark. 11(5): 428-38. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies