CEP68 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CEP68 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CEP68 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and rootletin depend both on each other for centriole association, and both also require CEP250 for their function.Protein Function: Involved in maintenance of centrosome cohesion, probably as part of a linker structure which prevents centrosome splitting (PubMed: 18042621). Required for localization of CDK5RAP2 to the centrosome during interphase (PubMed: 24554434, PubMed: 25503564). |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human CEP68 (ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID). Subcellular Localization: Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. |
| Other Names | [Centrosomal protein of 68 kDa; Cep68; CEP68; KIAA0582] |
| Gene, Accession # | [CEP68], Gene ID: 23177, NCBI: NP_001306029.1, UniProt: Q76N32 |
| Catalog # | MBS1750701 |
| Price | $280 |
| Order / More Info | CEP68 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies