Edit |   |
Antigenic Specificity | Integrin alpha 3B + alpha 6B |
Clone | [PB36] |
Host Species | Mouse |
Reactive Species | human |
Isotype | IgG1 |
Format | unconjugated |
Size | 0.1 mg |
Concentration | n/a |
Applications | Immunocytochemistry (IHC), Immunohistochemistry (IHC) (frozen), Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: PB36 recognizes the cytoplasmic domain of integrin subunits alpha3B and alpha6B. PB36 reacts with the basement membrane zone and endothelial cells in skin, tubuli in kidney and all vascular and capillary endothelia in brain and heart. Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Si |
Immunogen | Source Note: PB36 is a Mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. |
Other Names | n/a |
Gene, Accession # | n/a |
Catalog # | MBS570088 |
Price | $415 |
Order / More Info | Integrin alpha 3B + alpha 6B Antibody from MYBIOSOURCE INC. |
Product Specific References | de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63. |