Edit |   |
---|---|
Antigenic Specificity | Integrin Beta 8 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: Integrin Beta 8 antibody was raised against the C terminal of ITGB8. Rabbit polyclonal Integrin Beta 8 antibody raised against the C terminal of ITGB8 |
Immunogen | Immunogen: Integrin Beta 8 antibody was raised using the C terminal of ITGB8 corresponding to a region with amino acids CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL |
Other Names | [Integrin Beta 8; Integrin Beta 8; ITGB8] |
Gene, Accession # | Gene ID: 3696, NCBI: NP_002205.1 |
Catalog # | MBS5300290 |
Price | $430 |
Order / More Info | Integrin Beta 8 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |