IDO1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-IDO1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | IDO1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Indoleamine 2,3-dioxygenase 1(IDO1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO or IDO, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells. This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine. By fluorescence in situ hybridization, the assignment is narrowed to chromosome 8p12-p11. INDO Interferon-gamma has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase. During inflammation, IDO |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by seventeen amino acids. Ig Type: Rabbit IgG |
| Other Names | [Indoleamine 2,3-dioxygenase 1; 3-dioxygenase; I23O1_HUMAN; IDO 1; IDO; IDO-1; IDO1; INDO; indolamine 2,3 dioxygenase; Indole 2 3 dioxygenase; indoleamine 2 3 dioxygenase 1; indoleamine 2 3 dioxygenase; Indoleamine 2,3-dioxygenase 1; Indoleamine pyrrole 2 3 dioxygenase; Indoleamine-pyrrole 2; indoleamine 2,3-dioxygenase 1], [IDO1; IDO1; IDO; INDO; IDO-1; IDO; INDO; IDO-1] |
| Gene, Accession # | [IDO1], Gene ID: 3620, NCBI: NP_002155.1, UniProt: P14902 |
| Catalog # | MBS178128 |
| Price | $315 |
| Order / More Info | IDO1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Burkin, D. J., Kimbro, K. S., Barr, B. L., Jones, C., Taylor, M. W., Gupta, S. L. Localization of the human indoleamine 2,3-dioxygenase (IDO) gene to the pericentromeric region of human chromosome 8. Genomics 17: 262-263, 1993. 2. Dai, W., Gupta, S. L. Molecular cloning, sequencing and expression of human interferon-gamma-inducible indoleamine 2,3-dioxygenase cDNA. Biochem. Biophys. Res. Commun. 168: 1-8, 1990. 3. Fallarino, F., Grohmann, U., Hwang, K. W., Orabona, C., Vacca, C., Bianchi, R., Belladonna, M. L., Fioretti, M. C., Alegre, M.-L., Puccetti, P. Modulation of tryptophan catabolism by regulatory T cells. Nature Immun. 4: 1206-1212, 2003. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies