TIMP3 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-TIMP3 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | TIMP3 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | ELISA (EIA), Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Metalloproteinase inhibitor 3 is a protein that in humans is encoded by the TIMP3 gene. It is mapped to 22q12.1-q13.2. This gene belongs to the tissue inhibitor of metalloproteinases gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of theextracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.Protein Function: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding t |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL), different from the related mouse and rat sequences by two amino acids. Subcellular Localization: Secreted, extracellular space, extracellular matrix. |
| Other Names | [Metalloproteinase inhibitor 3; Protein MIG-5; Tissue inhibitor of metalloproteinases 3; TIMP-3; TIMP3] |
| Gene, Accession # | [TIMP3], Gene ID: 7078, NCBI: NP_000353.1, UniProt: P35625 |
| Catalog # | MBS1750417 |
| Price | $280 |
| Order / More Info | TIMP3 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies