Edit |   |
---|---|
Antigenic Specificity | LSAMP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: LSAMP antibody was raised against the N terminal of LSAMP. Rabbit polyclonal LSAMP antibody raised against the N terminal of LSAMP |
Immunogen | Immunogen: LSAMP antibody was raised using the N terminal of LSAMP corresponding to a region with amino acids MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI |
Other Names | [LSAMP; LSAMP; Limbic System-Associated Membrane Protein; LAMP] |
Gene, Accession # | [LSAMP], Gene ID: 4045, NCBI: NP_002329.2 |
Catalog # | MBS5302274 |
Price | $430 |
Order / More Info | LSAMP Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |