5HT2A Receptor Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-5HT2A Receptor antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | 5HT2A Receptor |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for 5-hydroxytryptamine receptor 2A(HTR2A) detection. Tested with WB in Human;Rat. Background: The mammalian HTR2A (5-HT2A receptor) is a subtype of the 5-HT2 receptor that belongs to the serotonin receptor family and is a G protein-coupled receptor (GPCR). This is the main excitatory receptor subtype among the GPCRs for serotonin (5-HT), although 5-HT2A may also have an inhibitory effect on certain areas such as the visual cortex and the orbit frontal cortex. This receptor was given importance first as the target of psychedelic drugs like LSD. Later it came back to prominence because it was also found to be mediating, at least partly, the action of many antipsychotic drugs, especially the atypica |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids. Ig Type: Rabbit IgG |
| Other Names | [5-hydroxytryptamine receptor 2A; 5 HT 2; 5 HT 2A; 5 HT2 receptor; 5 HT2A; 5 hydroxytryptamine receptor 2A; 5-HT-2; 5-HT-2A; 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled; 5-hydroxytryptamine 2A receptor; 5-hydroxytryptamine receptor 2A; 5HT2A_HUMAN; HTR 2; HTR 2A; HTR2; HTR2, formerly; HTR2A; serotonin 5-HT-2 receptor, formerly; serotonin 5-HT-2A receptor; Serotonin receptor 2A; 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled], [HTR2A; HTR2A; HTR2; 5-HT2A; HTR2; 5-HT-2; 5-HT-2A] |
| Gene, Accession # | Gene ID: 3356, NCBI: NP_000612.1, UniProt: P28223 |
| Catalog # | MBS178183 |
| Price | $315 |
| Order / More Info | 5HT2A Receptor Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Cook EH, Fletcher KE, Wainwright M, Marks N, Yan SY, Leventhal BL (August 1994). Primary structure of the human platelet serotonin 5-HT2 receptor: identity with frontal cortex serotonin 5-HT2A receptor. J. Neurochem. 63 (2): 465-9. 2. Elphick GF, Querbes W, Jordan JA, Gee GV, Eash S, Manley K, Dugan A, Stanifer M, Bhatnagar A, Kroeze WK, Roth BL, Atwood WJ (2004). The human polyomavirus, JCV, uses serotonin receptors to infect cells. Science 306 (5700): 1380-3. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies