ANGPTL3 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-ANGPTL3 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | ANGPTL3 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: ANGPTL3 (Angiopoietin-Like 3), also known as ANGPT5, is a protein which in humans is encoded by the ANGPTL3 gene. The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. By radiation hybrid mapping and the use of surrounding genes, this gene is mapped to chromosome 1p31. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil domain and the C-terminal fibrinogen (FBN)-like domain. Angptl3 also acts as dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL), and increases plasma triglyceride and HDL cholesterol in rodents. ANGPTL3 inhibit endothelial lipase to catalyze HDL-pho |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human ANGPTL3 (RFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLN). Subcellular Localization: Secreted. Tissue Specificity: Expressed principally in liver. Weakly expressed in kidney. Binds to adipocytes. Increased expression and colocalization with activated ITGB3 in glomeruli of patients with nephrotic syndrome showing effaced podocyte foot processes (at protein level). |
| Other Names | [Angiopoietin-related protein 3; Angiopoietin-5; ANG-5; Angiopoietin-like protein 3; ANGPTL3(17-221); ANGPTL3(17-224); ANGPTL3; ANGPT5; UNQ153/PRO179] |
| Gene, Accession # | [ANGPTL3], Gene ID: 27329, NCBI: NP_055310.1, UniProt: Q9Y5C1 |
| Catalog # | MBS1750800 |
| Price | $280 |
| Order / More Info | ANGPTL3 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies