CYP17A1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CYP17A1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CYP17A1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Steroid 17-alpha-hydroxylase/17, 20 lyase(CYP17A1) detection. Background: Cytochrome P450 17A1, also called steroid 17alpha-monooxygenase, is an enzyme of the hydroxylase type that in humans is encoded by the CYP17A1 gene on chromosome 10. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17, 20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, an |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CYP17A1 (383-419aa EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN), different from the related mouse and rat sequences by ten amino acids. |
| Other Names | [20 lyase; CPT7; CYP17; CYP17A1; CYPXVII; P450 C17; P450c17; S17AH; P05093; Steroid 17-alpha-hydroxylase/17, 20 lyase; cytochrome P450 family 17 subfamily A member 1], [CYP17A1; CYP17A1; CPT7; CYP17; S17AH; P450C17; CYP17; S17AH; Cytochrome P450c17] |
| Gene, Accession # | [CYP17A1], Gene ID: 1586, NCBI: NP_000093.1, UniProt: P05093 |
| Catalog # | MBS178614 |
| Price | $315 |
| Order / More Info | CYP17A1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. DeVore NM, Scott EE (February 2012). Structures of cytochrome P450 17A1 with prostate cancer drugs abiraterone and TOK-001. Nature. 482(7383): 116-9.2. Estrada DF, Laurence JS, Scott EE (February 2016). Cytochrome P450 17A1 Interactions with the FMN Domain of Its Reductase as Characterized by NMR. The Journal of Biological Chemistry. 291 (8): 3990-4003.3. Petrunak EM, DeVore NM, Porubsky PR, Scott EE (November 2014). Structures of human steroidogenic cytochrome P450 17A1 with substrates.The Journal of Biological Chemistry. 289 (47): 32952-64. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies