CPT1B Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CPT1B antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CPT1B |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids. Ig Type: Rabbit IgG |
| Other Names | [Carnitine O-palmitoyltransferase 1; muscle isoform; Carnitine O palmitoyltransferase I mitochondrial muscle isoform; Carnitine O palmitoyltransferase I muscle isoform; Carnitine O-palmitoyl transferase 1, muscle isoform; Carnitine O-palmitoyltransferase I; Carnitine palmitoyltransferase 1A (muscle); Carnitine palmitoyltransferase 1B (muscle); Carnitine palmitoyltransferase 1B; Carnitine palmitoyltransferase I like protein; Carnitine palmitoyltransferase I muscle; Carnitine palmitoyltransferase I-like protein; CPT 1B; CPT I; CPT1 M; CPT1 muscle; CPT1-M; Cpt1b; CPT1B_HUMAN; CPT1M; CPTI; CPTI M; CPTI muscle; CPTI-M; CPTIM; FLJ55729; FLJ58750; KIAA1670; M CPT1; M-CPT1; MCCPT1; MCPT1; muscle isoform; carnitine palmitoyltransferase 1B (muscle)], [CPT1B; CPT1B; CPTI; CPT1M; MCPT1; CPT1-M; CPTI-M; M-CPT1; MCCPT1; KIAA1670; CPT1-M; CPT I; CPTI-M] |
| Gene, Accession # | [CPT1B], Gene ID: 1375, NCBI: NP_001138606.1, UniProt: Q92523 |
| Catalog # | MBS177685 |
| Price | $315 |
| Order / More Info | CPT1B Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Auinger A; Rubin D; Sabandal M; Helwig U; Ruther A; Schreiber S; Foelsch UR; Doring F; Schrezenmeir J. A common haplotype of carnitine palmitoyltransferase 1b is associated with the metabolic syndrome. Br J Nutr, 2013 Mar 14. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies