Edit |   |
---|---|
Antigenic Specificity | ZSCAN2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 2.68 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ZSCAN2 (NP 870992.2). Immunogen Sequence: GPESEPFPQSAGKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSDFEIQSENGENCNQD |
Other Names | [ZSCAN2; ZFP29; ZNF854; zinc finger and SCAN domain containing 2] |
Gene, Accession # | [ZSCAN2], Gene ID: 54993, NCBI: AAI36343.1, UniProt: Q7Z7L9 |
Catalog # | MBS9141056 |
Price | $260 |
Order / More Info | ZSCAN2 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |