Edit |   |
Antigenic Specificity | Grp75 |
Clone | polyclonal |
Host Species | n/a |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followe |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
Other Names | [Stress-70 protein; 75 kDa glucose regulated protein; 75 kDa glucose-regulated protein; CSA; Glucose Regulated Protein; Grp 75; GRP-75; GRP75; GRP75_HUMAN; Heat shock 70 kDa protein 9; Heat shock 70kD protein 9; heat shock 70kDa protein 9; Heat shock 70kDa protein 9B; Heat shock protein 74 kDa A; Heat shock protein A; Heat shock protein cognate 74; Hsc74; Hsp74; Hsp74a; HSPA9; Hspa9a; HSPA9B; MGC4500; mitochondrial; Mortalin 2; Mortalin; Mortalin perinuclear; Mortalin2; MOT 2; MOT; MOT2; Mthsp70; p66 mortalin; P66 MOT; PBP74; Peptide binding protein 74; Peptide-binding protein 74; Stress 70 protein mitochondrial; Stress 70 protein mitochondrial precursor; Stress-70 protein; heat shock 70kDa protein 9 (mortalin)], [HSPA9; HSPA9; CSA; MOT; MOT2; SAAN; CRP40; EVPLS; GRP75; PBP74; GRP-75; HSPA9B; SIDBA4; MTHSP75; HEL-S-124m; GRP75; HSPA9B; mt-HSP70; GRP-75; MOT; PBP74] |
Gene, Accession # | [Grp75], Gene ID: 3313, NCBI: NP_004125.3, UniProt: P38646 |
Catalog # | MBS177947 |
Price | $315 |
Order / More Info | Grp75 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Chen, T. H.-P., Kambal, A., Krysiak, K., Walshauser, M. A., Raju, G., Tibbitts, J. F., Walter, M. J. Knockdown of Hspa9, a del(5q31.2) gene, results in a decrease in hematopoietic progenitors in mice. Blood 117: 1530-1539, 2011. 2. Gross, M. B. Personal Communication. Baltimore, Md. 9/12/2011. 3. Kaul, S. C., Wadhwa, R., Matsuda, Y., Hensler, P. J., Pereira-Smith, O. M., Komatsu, Y., Mitsui, Y. Mouse and human chromosomal assignments of mortalin, a novel member of the murine hsp70 family of proteins. FEBS Lett. 361: 269-272, 1995. |