Edit |   |
Antigenic Specificity | TMEM166/EVA1A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB), Immunohistochemistry (IHC) Frozen/Paraffin, Immunocytochemistry (ICC), Flow Cytometry (FC/FACS) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for TMEM166/EVA1A detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human; Mouse; Rat.Background: Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA). |
Other Names | [Protein eva-1 homolog A; Protein FAM176A; Transmembrane protein 166; EVA1A; FAM176A; TMEM166; SP24; Eva-1 homolog A, regulator of programmed cell death] |
Gene, Accession # | [TMEM166], Gene ID: 84141, NCBI: NP_001128504.1, UniProt: Q9H8M9 |
Catalog # | MBS1751521 |
Price | $315 |
Order / More Info | TMEM166/EVA1A Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Sun W, Ma XM, Bai JP, Zhang GQ, Zhu YJ, Ma HM, Guo H, Chen YY, Ding JB (2012). Transmembrane protein 166 expression in esophageal squamous cell carcinoma in Xinjiang, China. Asian Pacific Journal of Cancer Prevention. 13 (8): 3713-6. 2. Wang L, Yu C, Lu Y, He P, Guo J, Zhang C, Song Q, Ma D, Shi T, Chen Y (August 2007). TMEM166, a novel transmembrane protein, regulates cell autophagy and apoptosis. Apoptosis. 12 (8): 1489-502. |