Edit |   |
---|---|
Antigenic Specificity | SUR2A |
Clone | [S319A-14] |
Host Species | Mouse |
Reactive Species | mouse, rat |
Isotype | IgG2A |
Format | APC-Cy7 conjugate |
Size | 0.1 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Detects ~120 kDa. Does not cross-react with SUR2B. Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the e |
Immunogen | Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
Other Names | [Mouse Mouse SUR2A IgG2A; SUR2A : APC/Cy7; ABCC9; Sulfonylurea receptor 2; CMD10; ABC37; ATP-binding cassette transporter sub-family C member 9; Sulfonylurea receptor 2A; isoform SUR2A] |
Gene, Accession # | [SUR2A], Gene ID: 20928, NCBI: NP_001038185.1, UniProt: P70170 |
Catalog # | MBS8003280 |
Price | $510 |
Order / More Info | SUR2A Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042. 2. Nichols C.G. (2006) Nature. 440 (7083): 470-476. |