Edit |   |
---|---|
Antigenic Specificity | ARHGAP22 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 1.43 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a member of the GTPase activating protein family which activates a GTPase belonging to the RAS superfamily of small GTP-binding proteins. The encoded protein is insulin-responsive, is dependent on the kinase Akt and requires the Akt-dependent 14-3-3 binding protein which binds sequentially to two serine residues. The result of these interactions is regulation of cell motility. Multiple transcript variants encoding different isoforms have been found for this gene. |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 510-650 of human ARHGAP22 (NP 001242953.1). Immunogen Sequence: NVPAPGLVPGIPSVASMAWSGASSSESSVGGSLSSCTACRASDSSARSSLHTDWALEPSPLPSSSEDPKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVKRIEEGSADLRKR |
Other Names | [ARHGAP22; RhoGAP2; RhoGap22; rho GTPase-activating protein 22] |
Gene, Accession # | [ARHGAP22], Gene ID: 58504, NCBI: NP_001242953.1, UniProt: Q7Z5H3 |
Catalog # | MBS9140918 |
Price | $260 |
Order / More Info | ARHGAP22 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |