PDK4 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-PDK4 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | PDK4 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial(PDK4) detection. Tested with WB in Human;Mouse;Rat. Background: Pyruvate dehydrogenase lipoamide kinase isozyme 4, mitochondrial is an enzyme that in humans is encoded by the PDK4 gene. This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin. In addition, PD |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PDK4 (91-125aa WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN), different from the related mouse and rat sequences by three amino acids. Ig Type: Rabbit IgG |
| Other Names | [[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4; [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4; FLJ40832; mitochondrial; Pdk4; PDK4_HUMAN; Pyruvate dehydrogenase [lipoamide] kinase isozyme 4 mitochondrial; Pyruvate dehydrogenase kinase 4; Pyruvate dehydrogenase kinase isoenzyme 4; Pyruvate dehydrogenase kinase isoform 4; Pyruvate dehydrogenase kinase isozyme 4; Pyruvate dehydrogenase kinase isozyme 4 mitochondrial; pyruvate dehydrogenase kinase, isozyme 4], [PDK4; PDK4; PDHK4] |
| Gene, Accession # | [PDK4], Gene ID: 5166, NCBI: NP_002603.1, UniProt: Q16654 |
| Catalog # | MBS178182 |
| Price | $280 |
| Order / More Info | PDK4 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: PDK4 pyruvate dehydrogenase kinase, isozyme 4. 2. Andrews MT, Squire TL, Bowen CM, Rollins MB (Jul 1998). Low-temperature carbon utilization is regulated by novel gene activity in the heart of a hibernating mammal. Proceedings of the National Academy of Sciences of the United States of America 95 (14): 8392-7. 3. Gudi R, Bowker-Kinley MM, Kedishvili NY, Zhao Y, Popov KM (Dec 1995). Diversity of the pyruvate dehydrogenase kinase gene family in humans.The Journal of Biological Chemistry 270 (48): 28989-94. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies