HIF-2-alpha Antibody from MYBIOSOURCE INC.

Search, find, compare suppliers for anti-HIF-2-alpha antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityHIF-2-alpha
Clonepolyclonal
Host SpeciesRabbit
Reactive Speciesrat
Isotypen/a
Formatimmunogen affinity purified
Size0.1 mg
Concentrationn/a
ApplicationsWestern Blot (WB), Immunohistochemistry (IHC) Paraffin
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionDescription: Rabbit IgG polyclonal antibody for Endothelial PAS domain-containing protein 1(EPAS1) detection. Tested with WB, IHC-P in Rat. Background: HIF-2 alpha is also designated EPAS1 whose gene is mapped to 2p21-p16. The predicted mouse protein is 88% identical to human EPAS1. The human EPAS1 gene contains 15 exons and spans at least 120 kb. The positions of the introns within the genomic region encoding the N-terminal bHLH-PAS domains of EPAS1 and AHR are similar, suggesting that the 5-prime ends of the 2 genes may have arisen from a gene duplication event1. Moreover, the predicted protein shares 48% sequence identity with HIF1-alpha, a bHLH-PAS transcription factor that induces EPO gene expression in cultured cells in response to hy
ImmunogenImmunogen: A synthetic peptide corresponding to a sequence at N-terminus of rat HIF-2-alpha (202-240aa YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD).
Other Names[Endothelial PAS domain-containing protein 1(EPAS-1); endothelial PAS domain protein 1; Basic helix loop helix PAS protein MOP2; Basic-helix-loop-helix-PAS protein MOP2; bHLHe73; Class E basic helix-loop-helix protein 73; ECYT4; Endothelial PAS domain containing protein 1; Endothelial pas domain protein 1; Endothelial PAS domain-containing protein 1; EPAS 1; EPAS-1; EPAS1; EPAS1_HUMAN; HIF 1 alpha like factor; HIF 2 alpha; HIF-1-alpha-like factor; HIF-2-alpha; HIF2-alpha; Hif2a; HLF; Hypoxia inducible factor 2 alpha; Hypoxia inducible factor 2 alpha subunit; Hypoxia-inducible factor 2-alpha; Member of PAS protein 2; Member of pas superfamily 2; MOP 2; MOP2; PAS domain-containing protein 2; PASD2], [Epas1; Epas1; HLF; Hif2a; Hif2a; EPAS-1; HIF-2-alpha; HIF2-alpha]
Gene, Accession #[EPAS1], Gene ID: 29452, NCBI: Q9JHS1.1, UniProt: Q9JHS1
Catalog #MBS176076
Price$315
Order / More InfoHIF-2-alpha Antibody from MYBIOSOURCE INC.
Product Specific Referencesn/a
MYBIOSOURCE INC.
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166

sales@mybiosource.com

http://www.MyBioSource.com

Profile of MYBIOSOURCE INC.
Return to Antibodies

© 1980 - 2024 Linscott's Directory, Linscott's USA. All rights reserved.