Edit |   |
---|---|
Antigenic Specificity | HIF-2-alpha |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Rabbit IgG polyclonal antibody for Endothelial PAS domain-containing protein 1(EPAS1) detection. Tested with WB, IHC-P in Rat. Background: HIF-2 alpha is also designated EPAS1 whose gene is mapped to 2p21-p16. The predicted mouse protein is 88% identical to human EPAS1. The human EPAS1 gene contains 15 exons and spans at least 120 kb. The positions of the introns within the genomic region encoding the N-terminal bHLH-PAS domains of EPAS1 and AHR are similar, suggesting that the 5-prime ends of the 2 genes may have arisen from a gene duplication event1. Moreover, the predicted protein shares 48% sequence identity with HIF1-alpha, a bHLH-PAS transcription factor that induces EPO gene expression in cultured cells in response to hy |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at N-terminus of rat HIF-2-alpha (202-240aa YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD). |
Other Names | [Endothelial PAS domain-containing protein 1(EPAS-1); endothelial PAS domain protein 1; Basic helix loop helix PAS protein MOP2; Basic-helix-loop-helix-PAS protein MOP2; bHLHe73; Class E basic helix-loop-helix protein 73; ECYT4; Endothelial PAS domain containing protein 1; Endothelial pas domain protein 1; Endothelial PAS domain-containing protein 1; EPAS 1; EPAS-1; EPAS1; EPAS1_HUMAN; HIF 1 alpha like factor; HIF 2 alpha; HIF-1-alpha-like factor; HIF-2-alpha; HIF2-alpha; Hif2a; HLF; Hypoxia inducible factor 2 alpha; Hypoxia inducible factor 2 alpha subunit; Hypoxia-inducible factor 2-alpha; Member of PAS protein 2; Member of pas superfamily 2; MOP 2; MOP2; PAS domain-containing protein 2; PASD2], [Epas1; Epas1; HLF; Hif2a; Hif2a; EPAS-1; HIF-2-alpha; HIF2-alpha] |
Gene, Accession # | [EPAS1], Gene ID: 29452, NCBI: Q9JHS1.1, UniProt: Q9JHS1 |
Catalog # | MBS176076 |
Price | $315 |
Order / More Info | HIF-2-alpha Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |