RAB14 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-RAB14 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | RAB14 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Ras-related protein Rab-14(RAB14) detection. Tested with WB in Human;Rat. Background: Ras-related protein Rab-14 is a protein that in humans is encoded by the RAB14 gene. It is mapped to 9q33.2 based on an alignment of the RAB14 sequence with the genomic sequence. RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RAB14 (124-153aa NKADLEAQRDVTYEEAKQFAEENGLLFLEA), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
| Other Names | [Ras-related protein Rab-14; bA165P4.3; F protein binding protein 1; FBP; GTPase Rab14; RAB 14; RAB14; RAB14 member RAS oncogene family; RAB14_HUMAN; Ras related protein Rab 14; Ras-related protein Rab-14; RP11 165P4.4; Small GTP binding protein RAB14; RAB14, member RAS oncogene family], [RAB14; RAB14; FBP; RAB-14] |
| Gene, Accession # | [RAB14], Gene ID: 51552, NCBI: NP_057406.2, UniProt: P61106 |
| Catalog # | MBS178363 |
| Price | $280 |
| Order / More Info | RAB14 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: RAB14 RAB14, member RAS oncogene family. 2. de Leeuw HP, Koster PM, Calafat J, Janssen H, van Zonneveld AJ, van Mourik JA, Voorberg J (Dec 1998). Small GTP-binding proteins in human endothelial cells. Br J Haematol 103 (1): 15-9. 3. Junutula JR, De Maziere AM, Peden AA, Ervin KE, Advani RJ, van Dijk SM, Klumperman J, Scheller RH (Apr 2004). Rab14 is involved in membrane trafficking between the Golgi complex and endosomes. Mol Biol Cell15 (5): 2218-29. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies