Edit |   |
---|---|
Antigenic Specificity | TNFAIP8L1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: TNFAIP8L1 antibody was raised against the middle region of TNFAIP8L1. Rabbit polyclonal TNFAIP8L1 antibody raised against the middle region of TNFAIP8L1 |
Immunogen | Immunogen: TNFAIP8L1 antibody was raised using the middle region of TNFAIP8L1 corresponding to a region with amino acids AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL |
Other Names | [TNFAIP8L1; TNFAIP8L1; MGC17791; Tumor Necrosis Factor Alpha-Induced Protein 8-Like 1], [TNFAIP8L1; TNFAIP8L1; TIPE1; TNF alpha-induced protein 8-like protein 1; TNFAIP8-like protein 1] |
Gene, Accession # | [TNFAIP8L1], Gene ID: 531850, NCBI: AAI42332.1 |
Catalog # | MBS839254 |
Price | $430 |
Order / More Info | TNFAIP8L1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |