Edit |   |
---|---|
Antigenic Specificity | DUSP2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.92 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1 and ERK2, is predomina |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human DUSP2 (NP 004409.1). Immunogen Sequence: ALPPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSG |
Other Names | [DUSP2; PAC-1; PAC1; dual specificity phosphatase 2] |
Gene, Accession # | [DUSP2], Gene ID: 1844, NCBI: NP_004409, UniProt: Q05923 |
Catalog # | MBS9140813 |
Price | $260 |
Order / More Info | DUSP2 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |