Human SUR1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Human SUR1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Human SUR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | DyLight 488 conjugate |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Flow Cytometry (FC/FACS) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglyc |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA). |
| Other Names | [Rabbit IgG Human SUR1 DyLight 488 Conjugated, Flow Validated; ATP binding cassette subfamily C member 8; ATP-binding cassette sub-family C member 8; Sulfonylurea receptor 1; ABCC8; HRINS; SUR; SUR1] |
| Gene, Accession # | [SUR1], Gene ID: 6833, NCBI: NP_000343.2, UniProt: Q09428 |
| Catalog # | MBS1751284 |
| Price | $330 |
| Order / More Info | Human SUR1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: ABCC8 ATP-binding cassette, sub-family C (CFTR/MRP), member 8. 2. Glaser B, Chiu KC, Anker R, Nestorowicz A, Landau H, Ben-Bassat H, Shlomai Z, Kaiser N, Thornton PS, Stanley CA, et al. (Nov 1994). Familial hyperinsulinism maps to chromosome 11p14-15.1, 30 cM centromeric to the insulin gene. Nat Genet. 7 (2): 185-8. 3. Thomas PM, Cote GJ, Wohllk N, Haddad B, Mathew PM, Rabl W, Aguilar-Bryan L, Gagel RF, Bryan J (May 1995). Mutations in the sulfonylurea receptor gene in familial persistent hyperinsulinemic hypoglycemia of infancy. Science. 268 (5209): 426-9. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies