Melanoma gp100/PMEL Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Melanoma gp100/PMEL antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Melanoma gp100/PMEL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for Melanoma gp100/PMEL detection. Tested with WB in Human; Mouse; Rat.Background: This gene is mapped to 12q13.2. It encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human Melanoma gp100/PMEL (KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD). |
| Other Names | [Melanocyte protein PMEL; ME20-M; ME20M; Melanocyte protein Pmel 17; Melanocytes lineage-specific antigen GP100; Melanoma-associated ME20 antigen; P1; P100; Premelanosome protein; Silver locus protein homolog; M-alpha; 95 kDa melanocyte-specific secreted glycoprotein; P26; Secreted melanoma-associated ME20 antigen; ME20-S; ME20S; M-beta; PMEL; D12S53E; PMEL17; SILV; Premelanosome protein] |
| Gene, Accession # | [PMEL], Gene ID: 6490, NCBI: NP_001186982.1, UniProt: P40967 |
| Catalog # | MBS1751322 |
| Price | $280 |
| Order / More Info | Melanoma gp100/PMEL Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Adema, G. J., de Boer, A. J., Vogel, A. M., Loenen, W. A. M., Figdor, C. G. Molecular characterization of the melanocyte lineage-specific antigen gp100. J. Biol. Chem. 269: 20126-20133, 1994. 2. Bailin, T., Lee, S.-T., Spritz, R. A. Genomic organization and sequence of D12S53E (Pmel 17), the human homologue of the mouse silver (si) locus. J. Invest. Derm. 106: 24-27, 1996. 3. Berson, J. F., Harper, D. C., Tenza, D., Raposo, G., Marks, M. S. Pmel17 initiates premelanosome morphogenesis within multivesicular bodies. Molec. Biol. Cell 12: 3451-3464, 2001. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies