EPCAM Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-EPCAM antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | EPCAM |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Epithelial cell adhesion molecule(EPCAM) detection. Background: Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell-cell adhesion in epithelia. This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen amino acids. |
| Other Names | [AUA1; CD326; CD326 antigen; CO 17A; CO17 1A; CO17A; DIAR5; EGP 2; EGP; EGP2; EGP314; EGP40; Ep CAM; EpCAM; Ep-CAM; Epithelial glycoprotein; ESA; GA733 1; GA733 2; GA733-2; KS1/4; M1S 1; M1S2; M4S1; MIC18; MK 1; TACD1; TACSTD1; TROP1; P16422; Epithelial cell adhesion molecule], [EPCAM; EPCAM; ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; EGP314; HNPCC8; TACSTD1; GA733-2; M1S2; M4S1; MIC18; TACSTD1; TROP1; Ep-CAM; EGP; EGP314; hEGP314] |
| Gene, Accession # | [EPCAM], Gene ID: 4072, NCBI: NP_002345.2, UniProt: P16422 |
| Catalog # | MBS178815 |
| Price | $315 |
| Order / More Info | EPCAM Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Litvinov, Sergey; et al. (1994). Ep-CAM: a human epithelial antigen is a homophilic cell-cell adhesion molecule. The Journal of Cell Biology 125 (2): 437-46.2. Maetzel, Dorothea; et al. (2009). Nuclear signalling by tumour-associated antigen EpCAM. Nature Cell Biology 11 (2): 162-71. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies