Edit |   |
---|---|
Antigenic Specificity | GAPDH |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit IgG polyclonal antibody for Glyceraldehyde-3-phosphate dehydrogenase(GAPDH) detection. Background: Glyceraldehyde 3-phosphate dehydrogenase (abbreviated as GAPDH or less commonly as G3PDH) is an enzyme of ~37kDa that catalyzes the sixth step of glycolysis and thus serves to break down glucose for energy and carbon molecules. This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. GAPDH is mapped to 12p13.31. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phos |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GAPDH (302-335aa ALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE), different from the related mouse and rat sequences by three amino acids. |
Other Names | [EC 1.2.1.12; EC1.2.1.12; G3P; GAPD; GAPDH; P04406; Glyceraldehyde-3-phosphate dehydrogenase], [GAPDH; GAPDH; G3PD; GAPD; HEL-S-162eP; GAPD; GAPDH] |
Gene, Accession # | [GAPDH], Gene ID: 2597, NCBI: NP_001243728.1, UniProt: P04406 |
Catalog # | MBS178595 |
Price | $280 |
Order / More Info | GAPDH Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Bae, B.-I., Hara, M. R., Cascio, M. B., Wellington, C. L., Hayden, M. R., Ross, C. A., Ha, H. C., Li, X.-J., Snyder, S. H., Sawa, A. Mutant Huntingtin: nuclear translocation and cytotoxicity mediated by GAPDH. Proc. Nat. Acad. Sci. 103: 3405-3409, 2006.2. Colell, A., Ricci, J.-E., Tait, S., Milasta, S., Maurer, U., Bouchier-Hayes, L., Fitzgerald, P., Guio-Carrion, A., Waterhouse, N. J., Li, C. W., Mari, B., Barbry, P., Newmeyer, D. D., Beere, H. M., Green, D. R. GAPDH and autophagy preserve survival after apoptotic cytochrome c release in the absence of caspase activation. Cell 129: 983-997, 2007. Note: Erratum: Cell 130: 385 only, 2007.3. Tarze A, Deniaud A, Le Bras M, Maillier E, Molle D, Larochette N, Zamzami N, Jan G, Kroemer G, Brenner C (April 2007). GAPDH, a novel regulator of the pro-apoptotic mitochondrial membrane permeabilization.Oncogene 26 (18): 2606-20. |