EWSR1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-EWSR1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | EWSR1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for RNA-binding protein EWS(EWSR1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of t |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid. Ig Type: Rabbit IgG |
| Other Names | [RNA-binding protein EWS; bK984G1.4; bK984G1.4 Ewing sarcoma breakpoint region 1 protein; Ewing sarcoma breakpoint region 1; Ewing sarcoma breakpoint region 1 protein; Ewings sarcoma EWS Fli1 type 1 oncogene; EWS; EWS oncogene; EWS RNA binding protein 1; EWS_HUMAN; EWSR 1; Ewsr1; EWSR1 protein; RNA binding protein EWS; RNA-binding protein EWS; EWS RNA-binding protein 1], [EWSR1; EWSR1; EWS; EWS-FLI1; bK984G1.4; EWS] |
| Gene, Accession # | [EWSR1], Gene ID: 2130, NCBI: NP_001156757.1, UniProt: Q01844 |
| Catalog # | MBS178219 |
| Price | $315 |
| Order / More Info | EWSR1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: EWSR1 Ewing sarcoma breakpoint region 1. 2. Delattre O, Zucman J, Plougastel B, Desmaze C, Melot T, Peter M, Kovar H, Joubert I, de Jong P, Rouleau G (October 1992). Gene fusion with an ETS DNA-binding domain caused by chromosome translocation in human tumours. Nature 359 (6391): 162-5. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies