Edit |   |
---|---|
Antigenic Specificity | NLGN1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.07 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NLGN1 (NP 055747.1). Immunogen Sequence: YGNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTAL |
Other Names | [NLGN1; NL1; neuroligin-1] |
Gene, Accession # | [NLGN1], Gene ID: 22871, NCBI: NP_055747, UniProt: Q8N2Q7 |
Catalog # | MBS9140718 |
Price | $260 |
Order / More Info | NLGN1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |