Edit |   |
---|---|
Antigenic Specificity | Serotonin receptor 2B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal Serotonin receptor 2B antibody |
Immunogen | Immunogen: Serotonin receptor 2B antibody was raised using a synthetic peptide corresponding to a region with amino acids QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK |
Other Names | [Serotonin receptor 2B; Serotonin receptor 2B; 5-Hydroxytryptamine; 5-HT(2B); HTR2B; 5-HT2B] |
Gene, Accession # | Gene ID: 751784, NCBI: ABI18978.1 |
Catalog # | MBS5300790 |
Price | $430 |
Order / More Info | Serotonin receptor 2B Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |