FMO1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-FMO1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | FMO1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 1(FMO1) detection. Tested with WB in Human;Mouse; Rat. Background: Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidati |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. Ig Type: Rabbit IgG |
| Other Names | [Dimethylaniline monooxygenase [N-oxide-forming] 1; Dimethylaniline monooxygenase [N oxide forming] 1; Dimethylaniline monooxygenase [N-oxide-forming] 1; Dimethylaniline oxidase 1; Fetal hepatic flavin containing monooxygenase 1; Fetal hepatic flavin-containing monooxygenase 1; Flavin containing monooxygenase 1 (fetal liver); Flavin Containing Monooxygenase 1; FMO 1; FMO1; FMO1_HUMAN; OTTHUMP00000033536; OTTHUMP00000033537; flavin containing monooxygenase 1], [FMO1; FMO1; FMO 1] |
| Gene, Accession # | [FMO1], Gene ID: 2326, NCBI: NP_001269621.1, UniProt: Q01740 |
| Catalog # | MBS178094 |
| Price | $280 |
| Order / More Info | FMO1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: FMO1 flavin containing monooxygenase 1. 2. Cashman JR (2004). The implications of polymorphisms in mammalian flavin-containing monooxygenases in drug discovery and development.Drug Discov. Today 9 (13): 574-581. 3. Dolphin C, Shephard EA, Povey S et al. (1991). Cloning, primary sequence, and chromosomal mapping of a human flavin-containing monooxygenase (FMO1).J. Biol. Chem. 266 (19): 12379-85. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies