IRF2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-IRF2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | IRF2 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Interferon regulatory factor 2(IRF2) detection. Tested with WB in Human;Rat. Background: IRF2 (interferon regulatory factor 2) is a member of the interferon regulatory transcription factor (IRF) family. The IRF2 gene is mapped on 4q35.1. When the IRF2 gene was overexpressed in NIH 3T3 cells, the cells became transformed and displayed enhanced tumorigenicity in nude mice. One IRF binding site was found within the IRF2 promoter, and expression of the IRF2 gene was affected by both transient and stable IRF1 expression. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. Ho |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IRF2 (317-348aa MTPASSSSRPDRETRASVIKKTSDITQARVKS), different from the related mouse sequence by three amino acids. Ig Type: Rabbit IgG |
| Other Names | [Interferon regulatory factor 2; DKFZp686F0244; Interferon regulatory factor 2; IRF 2; IRF-2; IRF2; IRF2_HUMAN; interferon regulatory factor 2], [IRF2; IRF2; IRF-2; IRF-2] |
| Gene, Accession # | [IRF2], Gene ID: 3660, NCBI: NP_002190.2, UniProt: P14316 |
| Catalog # | MBS178321 |
| Price | $280 |
| Order / More Info | IRF2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Harada, H., Takahashi, E.-I., Itoh, S., Harada, K., Hori, T.-A., Taniguchi, T. Structure and regulation of the human interferon regulatory factor 1 (IRF-1) and IRF-2 genes: implications for a gene network in the interferon system. Molec. Cell. Biol. 14: 1500-1509, 1994. 2. Nishio, Y., Noguchi, E., Ito, S., Ichikawa, E., Umebayashi, Y., Otsuka, F., Arinami, T. Mutation and association analysis of the interferon regulatory factor 2 gene (IRF2) with atopic dermatitis. J. Hum. Genet. 46: 664-667, 2001. 3. Taki, S., Nakajima, S., Ichikawa, E., Saito, T., Hida, S. IFN regulatory factor-2 deficiency revealed a novel checkpoint critical for the generation of peripheral NK cells. J. Immun. 174: 6005-6012, 2005. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.