TIM 1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-TIM 1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | TIM 1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Hepatitis A virus cellular receptor 1 homolog(HAVcr-1)(HAVCR1) detection. Tested with WB in Human. Background: KIM1 (KIDNEY INJURY MOLECULE 1), also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the KIM1 gene. The KIM1 gene is mapped to 5q33.3. Biochemical, mutational, and cell adhesion analyses confirm that Tim1 is capable of homophilic Tim-Tim interactions. The features identified in murine KIM1 are conserved in human KIM1. The KIM1 protein is indeed a receptor for the virus through the infection of canine osteogenic sarcoma cells expressing HAVCR1 with HAV. Using a monoclonal antibody to mouse Tim1, Tim1 is expressed after activation of naive T cells and on T cel |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD). Ig Type: Rabbit IgG |
| Other Names | [Hepatitis A virus cellular receptor 1 homolog(HAVcr-1); HAVCR 1; HAVcr-1; HAVCR1; Hepatitis A virus cellular receptor 1; Kidney injury molecule 1; KIM 1; KIM-1; T cell immunoglobin domain and mucin domain protein 1; T-cell immunoglobulin and mucin domain-containing protein 1; T-cell membrane protein 1; TIM; TIM-1; TIM1; TIMD 1; TIMD-1; TIMD1; TIMD1_HUMAN; hepatitis A virus cellular receptor 1], [HAVCR1; HAVCR1; TIM; KIM1; TIM1; CD365; HAVCR; KIM-1; TIM-1; TIMD1; TIMD-1; HAVCR-1; KIM1; TIM1; TIMD1; HAVcr-1; KIM-1; TIMD-1; TIM; TIM-1] |
| Gene, Accession # | [TIM 1], Gene ID: 26762, NCBI: NP_001166864.1, UniProt: Q96D42 |
| Catalog # | MBS178086 |
| Price | $280 |
| Order / More Info | TIM 1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. de Souza, A. J., Oriss, T. B., O'Malley, K. J., Ray, A., Kane, L. P. T cell Ig and mucin 1 (TIM-1) is expressed on in vivo-activated T cells and provides a costimulatory signal for T cell activation. Proc. Nat. Acad. Sci. 102: 17113-17118, 2005. 2. Feigelstock, D., Thompson, P., Mattoo, P., Zhang, Y., Kaplan, G. G. The human homolog of HAVcr-1 codes for a hepatitis A virus cellular receptor. J. Virol. 72: 6621-6628, 1998. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies