Edit |   |
---|---|
Antigenic Specificity | C10ORF56 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: C10ORF56 antibody was raised against the middle region of C10Orf56. Rabbit polyclonal C10ORF56 antibody raised against the middle region of C10Orf56 |
Immunogen | Immunogen: C10ORF56 antibody was raised using the middle region of C10Orf56 corresponding to a region with amino acids LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL |
Other Names | [C10ORF56; C10ORF56; Chromosome ORF-10; Chromosome ORF 10; Chromosome 10 ORF; FLJ90798], [ZCCHC24; ZCCHC24; Z3CXXC8; C10orf56; C10orf56] |
Gene, Accession # | [C10ORF56], Gene ID: 219654, NCBI: EAW54650.1 |
Catalog # | MBS839493 |
Price | $430 |
Order / More Info | C10ORF56 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |