Beta Tubulin Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Beta Tubulin antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Beta Tubulin |
| Clone | [2E11] |
| Host Species | Mouse |
| Reactive Species | human, mouse, rat |
| Isotype | IgG2a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Flow Cytometry (FC/FACS) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Mouse IgG monoclonal antibody for Beta Tubulin detection. Tested with WB, FCM in Human; Mouse; Rat.Background: Tubulin beta chain is a protein that in humans is encoded by the TUBB gene. This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences. |
| Other Names | [Tubulin beta chain; Tubulin beta-5 chain; TUBB; TUBB5; OK/SW-cl.56] |
| Gene, Accession # | [TUBB], Gene ID: 203068, NCBI: NP_821133.1, UniProt: P07437 |
| Catalog # | MBS1752903 |
| Price | $280 |
| Order / More Info | Beta Tubulin Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: TUBB tubulin, beta. 2. Volz A, Weiss E, Trowsdale J, Ziegler A (Jan 1994). Presence of an expressed beta-tubulin gene (TUBB) in the HLA class I region may provide the genetic basis for HLA-linked microtubule dysfunction. Human Genetics. 93 (1): 42-6. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies