PDPK1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-PDPK1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | PDPK1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for 3-phosphoinositide-dependent protein kinase 1(PDPK1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: 3-phosphoinositide dependent protein kinase-1, also known as PDPK1, is a protein which in humans is encoded by the PDPK1 gene. It is mapped to 16p13.3. PDPK1 is a master kinase, which is crucial for the activation of AKT/PKB and many other AGC kinases including PKC, S6K, SGK. An important role for PDPK1 is in the signalling pathways activated by several growth factors and hormones including insulin signaling. Mice lacking PDPK1 die during early embryonic development, indicating that this enzyme is critical for transmitting the growth-promoting signals necessary for normal mamma |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PDPK1 (524-556aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ), different from the related mouse and rat sequences by two amino acids. Ig Type: Rabbit IgG |
| Other Names | [3-phosphoinositide-dependent protein kinase 1; 3 phosphoinositide dependent protein kinase 1; 3-phosphoinositide-dependent protein kinase 1; hPDK 1; hPDK1; MGC20087; MGC35290; OTTHUMP00000159109; OTTHUMP00000159110; OTTHUMP00000174525; PDK1; Pdpk1; PDPK1_HUMAN; PDPK2; PkB kinase; PkB kinase like gene 1; PkB like 1; PRO0461; Protein kinase; 3-phosphoinositide dependent protein kinase 1], [PDPK1; PDPK1; PDK1; PDPK2; PDPK2P; PRO0461; PDK1; hPDK1] |
| Gene, Accession # | [PDPK1], Gene ID: 5170, NCBI: NP_001248745.1, UniProt: O15530 |
| Catalog # | MBS177711 |
| Price | $315 |
| Order / More Info | PDPK1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: PDPK1. 2. Mora A, Komander D, van Aalten DM, Alessi DR (April 2004). PDK1, the master regulator of AGC kinase signal transduction. Semin. Cell Dev. Biol. 15 (2): 161-70. 3. Scortegagna M, Ruller C, Feng Y, Lazova R, Kluger H, Li JL, De SK, Rickert R, Pellecchia M, Bosenberg M, Ronai ZA (2014). Genetic inactivation or pharmacological inhibition of Pdk1 delays development and inhibits metastasis of Braf(V600E)::Pten(-/-) melanoma. Oncogene 33(34): 4330-9. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies