MMP3 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-MMP3 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | MMP3 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Stromelysin-1(MMP3) detection. Tested with WB in Human. Background: Stromelysin-1, also known as matrix metalloproteinase-3 (MMP-3), is an enzyme that in humans is encoded by the MMP3 gene. It is mapped to 11q22.2. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix and during tissue remodeling in normal physiological processes, such as embryonic development and reproduction, as well as in disease processes, such as arthritis, and tumour metastasis. The MMP-3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, MMP-3 can also activate other MMPs such as MMP-1, MMP-7, and MMP |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3(410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids. Ig Type: Rabbit IgG |
| Other Names | [Stromelysin-1; CHDS6; Matrix metalloproteinase 3; Matrix metalloproteinase 3 preproprotein; Matrix metalloproteinase-3; MGC126102; MGC126103; MGC126104; MMP 3; MMP-3; MMP3; MMP3_HUMAN; Progelatinase; Proteoglycanase; SL 1; SL-1; SL1; STMY; STMY1; STR1; Stromelisin 1; Stromelysin 1; Stromelysin 1 progelatinase; Stromelysin-1; Transin 1; Transin-1; matrix metallopeptidase 3 (stromelysin 1, progelatinase)], [MMP3; MMP3; SL-1; STMY; STR1; CHDS6; MMP-3; STMY1; STMY1; SL-1; MMP-3] |
| Gene, Accession # | [MMP3], Gene ID: 4314, NCBI: NP_002413.1, UniProt: P08254 |
| Catalog # | MBS177674 |
| Price | $280 |
| Order / More Info | MMP3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: MMP3 matrix metallopeptidase 3 (stromelysin 1, progelatinase) 2. Lu, P. C.-S., Ye, H., Maeda, M., Azar, D. T. Immunolocalization and gene expression of matrilysin during corneal wound healing. Invest. Ophthal. Vis. Sci. 40: 20-27, 1999. 3. Ye S, Eriksson P, Hamsten A, Kurkinen M, Humphries SE, Henney AM (May 1996). Progression of coronary atherosclerosis is associated with a common genetic variant of the human stromelysin-1 promoter which results in reduced gene expression. J. Biol. Chem. 271 (22): 13055-60. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies