SUR2A Antibody from NEUROMAB
Search, find, compare suppliers for anti-SUR2A antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SUR2A |
| Clone | N319A/14 |
| Host Species | Mouse |
| Reactive Species | mouse and rat |
| Isotype | IgG2a |
| Format | FL594 conjugate |
| Size | 200 µL |
| Concentration | 0.5 mg/mL |
| Applications | ICC, IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse anti-SUR2A monoclonal antibody, FL594 conjugated. Does not cross-react with SUR2B. RRID: AB_2940042 |
| Immunogen | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (accession number P70170) produced recombinantly in E. Coli |
| Other Names | ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2) |
| Gene, Accession # | Abcc9 Sur2, UniProt: P70170 |
| Catalog # | 75-296-FL594 |
| Price | $460 |
| Order / More Info | SUR2A Antibody from NEUROMAB |
| Product Specific References | n/a |
NEUROMAB
NEUROMAB
Produced and sold by Antibodies Inc.
P.O. Box 1560
Davis CA 95617-1560
P: (530) 758-4400
P: (800) 824-8540
F: (530) 758-6307
info@antibodiesinc.com
Ordering: orders@antibodiesinc.com
https://www.antibodiesinc.com/
Profile of NEUROMAB