Myocilin Antibody from NOVUS BIOLOGICALS, LLC

Search, find, compare suppliers for anti-Myocilin antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityMyocilin
Clonepolyclonal
Host SpeciesRabbit
Reactive Specieshuman
Isotypen/a
Formatimmunogen affinity purified
Size0.1 ml
Concentrationn/a
ApplicationsWestern Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionSpecificity: Specificity of human Myocilin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. The Myocilin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Myocilin. This antibody reacts with human. The Myocilin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
ImmunogenMyocilin Antibody was developed against Recombinant Protein corresponding to amino acids: NLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRIL
Other NamesGLC1Amyocilin, GPOA, JOAG, JOAG1, myocilin, trabecular meshwork inducible glucocorticoid response, TIGRmutated trabecular meshwork-induced glucocorticoid response protein, Trabecular meshwork-induced glucocorticoid response protein
Gene, Accession #MYOC, Gene ID: 4653
Catalog #NBP1-89769
Price$429 / €342 / £263
Order / More InfoMyocilin Antibody from NOVUS BIOLOGICALS, LLC
Product Specific Referencesn/a
NOVUS BIOLOGICALS, LLC
NOVUS BIOLOGICALS, LLC
NOVUS BIOLOGICALS, LLC
8100 Southpark Way, A-8
Littleton CO 80120
P: 303-730-1950
F: 303-730-1966

novus@novusbio.com

http://www.novusbio.com

EUROPEAN OFFICE:
R&D Systems Europe Ltd.
Phone: +44 (0) 1235 529449
Fax: +44 (0) 1235 533420
Email: info@bio-techne.com
Address: 19 Barton Lane
Abingdon Science Park
Abingdon, OX14 3NB, UK

CANADIAN OFFICE:
Novus Biologicals Canada ULC
Phone: 855-668-8722 (855-NOVUS-CA)
Fax: 905-827-6402
Email: canada@novusbio.com
Address: 461 North Service Road West
Unit B37
Oakville, ON L6M 2V5 Canada


Profile of NOVUS BIOLOGICALS, LLC
Return to Antibodies

© 1980 - 2019 Linscott's Directory, Linscott's USA. All rights reserved.