Edit |   |
---|---|
Antigenic Specificity | SUR2A |
Clone | S319A-14 |
Host Species | Mouse |
Reactive Species | human, mouse, rat |
Isotype | IgG2a |
Format | fluorescein (FITC) conjugate |
Size | 100 µg |
Concentration | 1 mg/ml |
Applications | WB, IHC, ICC/IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-Mouse SUR2A Monoclonal IgG2A. Detects ~120kDa. Does not cross-react with SUR2B. |
Immunogen | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
Other Names | ABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2A |
Gene, Accession # | Gene ID: 20928, Accession: NP_001038185.1, SwissProt: P70170 |
Catalog # | SMC-431D-FITC |
Price | please inquire |
Order / More Info | SUR2A Antibody from STRESSMARQ BIOSCIENCES INC. |
Product Specific References | n/a |