Edit |   |
---|---|
Antigenic Specificity | SLC25A25 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SLC25A25 polyclonal antibody, unconjugated |
Immunogen | SLC25 A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV |
Other Names | MCSC|PCSCL|RP11-395P17.4|SCAMC-2|calcium-binding mitochondrial carrier protein SCaMC-2|mitochondrial ATP-MgPi carrier protein 3|mitochondrial Ca(2+)-dependent solute carrier protein 3|short calcium-binding mitochondrial carrier 2|small calcium-binding mitochondrial carrier 2|solute carrier family 25|member 25|solute carrier family 25 member 25|SLC25A25|Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25|1110030N17Rik|mKIAA1896|mitochondrial Ca2+-dependent solute carrier|small calcium-binding mitochondrial carrier protein 2|ATP-MgPi carrier|mitochondrial ATP-MgPi carrier protein|peroxisomal Ca(2+)-dependent solute carrier-like protein|peroxisomal Ca-dependent solute carrier-like protein|scamc2|solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25 L homeolog|slc25a25.L|slc25a|wu:fb13d12|wu:fd14e03|zgc:77454|calcium-binding mitochondrial carrier protein SCaMC-2-A|small calcium-binding mitochondrial carrier protein 2-A|solute carrier family 25 (mitochondrial carrier; phosphate carrier)|solute carrier family 25 member 25-A|solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25a|slc25a25a|solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25|solute carrier family 25 (mitochondrial carrier|phosphate carrier)|calcium-binding mitochondrial carrier protein SCaMC-2-like|LOW QUALITY PROTEIN: calcium-binding mitochondrial carrier protein SCaMC-2 |
Gene, Accession # | Gene ID: 114789, 227731, 246771, 491321 |
Catalog # | ABIN635360 |
Price | $1020 |
Order / More Info | SLC25A25 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |