Edit |   |
---|---|
Antigenic Specificity | KCNQ2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KCNQ2 polyclonal antibody, unconjugated |
Immunogen | KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI |
Other Names | BFNC|BFNS1|EBN|EBN1|EIEE7|ENB1|HNSPC|KCNA11|KV7.2|KVEBN1|KQT-like 2|neuroblastoma-specific potassium channel protein|neuroblastoma-specific potassium channel subunit alpha KvLQT2|potassium voltage-gated channel subfamily KQT member 2|voltage-gated potassium channel subunit Kv7.2|potassium voltage-gated channel subfamily Q member 2|KCNQ2|Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2|KQT2|Nmf134|potassium channel subunit alpha KvLQT2|potassium voltage-gated channel, subfamily Q, member 2|potassium voltage-gated channel|subfamily Q|member 2|LOC100537363|mKQT2.3|mKQT2.4|potassium voltage-gated channel KQT-like subfamily member 2.3|potassium voltage-gated channel KQT-like subfamily member 2.4|KQT-like subfamily|LOW QUALITY PROTEIN: potassium voltage-gated channel subfamily KQT member 2|zgc:171872|uncharacterized protein LOC100141342|potassium voltage-gated channel, KQT-like subfamily, member 2a|kcnq2a |
Gene, Accession # | Gene ID: 3785, 16536, 170848, 612515 |
Catalog # | ABIN630098 |
Price | $902 |
Order / More Info | KCNQ2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |