Edit |   |
---|---|
Antigenic Specificity | Glypican 3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Glypican 3 polyclonal antibody, unconjugated |
Immunogen | GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL |
Other Names | DGSX|GTR2-2|MXR7|OCI-5|SDYS|SGB|SGBS|SGBS1|glypican proteoglycan 3|glypican-3|heparan sulphate proteoglycan|intestinal protein OCI-5|secreted glypican-3|glypican 3|GPC3|defective in Simpson-Golabi-Behmel overgrowth syndrome|proteoglycan GPC3|glypican-3-like |
Gene, Accession # | Gene ID: 2719, 14734, 25236, 481056 |
Catalog # | ABIN630140 |
Price | $902 |
Order / More Info | Glypican 3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |