Edit |   |
---|---|
Antigenic Specificity | TRPV5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TRPV5 polyclonal antibody, unconjugated |
Immunogen | TRPV5 antibody was raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA |
Other Names | CaT2|Ecac1|OTRPC3|calcium transporter 2|epithelial calcium channel 1|osm-9-like TRP channel 3|transient receptor potential cation channel subfamily V member 5|transient receptor potential cation channel, subfamily V, member 5|Trpv5|ECaC|calcium transport protein 2|D630033B11|transient receptor potential cation channel|subfamily V|member 5|LOC100011049|xcat2|calcium transporter 2 L homeolog|cat2.L |
Gene, Accession # | Gene ID: 56302 |
Catalog # | ABIN633749 |
Price | $1020 |
Order / More Info | TRPV5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |